Hieararchical diagram vector image
Home/black/Hieararchical diagram vector image

Hieararchical diagram vector image

Vector illustration of a hierarchical diagram. Black and white drawing of a blank chart structure.

0.01 MB size 206 downloads 30/08/2014 by OpenClipart
↓ Download SVG Large PNG 2400px Small PNG 300px

Public Domain (CC0) · free for commercial use, no attribution required.

Related Tags

blackclipartdiagramhierarchysvgtreewhitebinary tree data structure digraph ontology

Specs

SVG ID
13498
Format
SVG, PNG
License
Public Domain

Related SVG images

See more →
Leafless tree vector silhouette

Leafless tree vector silhouette
Bear up a tree

Bear up a tree
Gold tree image

Gold tree image
Black and white circles

Black and white circles
Black and white decorative pattern

Black and white decorative pattern
Black and white squares and circles pattern

Black and white squares and circles pattern
Black and retro boy

Black and retro boy
Data Structure Chart

Data Structure Chart
Branching tree diagram

Branching tree diagram
Binary Data Stream

Binary Data Stream
Binary Data Stream

Binary Data Stream
binary tree

binary tree
Your experience on this site will be improved by allowing cookies.