Vector clip art of walking man icon
Home/B/Vector clip art of walking man icon

Vector clip art of walking man icon

Vector image of walking man icon. Illustration of black and white pedestrian sign.

0.00 MB size 3,569 downloads 27/01/2015 by OpenClipart
↓ Download SVG Large PNG 2400px Small PNG 300px

Public Domain (CC0) · free for commercial use, no attribution required.

Related Tags

Bclip articonmanpedestrianpeoplesignsimplifiedsvgtrafficwalkingstick figure rimanalogi

Specs

SVG ID
21415
Format
SVG, PNG
License
Public Domain

Related SVG images

See more →
Part of pedestrian crossing sign vector image

Part of pedestrian crossing sign vector image
Seated Stick Figure

Seated Stick Figure
Stick figure walking

Stick figure walking
Blue stick figure

Blue stick figure
Stick figure vector

Stick figure vector
Stick Figure

Stick Figure
Toilet urge stick figure

Toilet urge stick figure
Stick figure with big pen

Stick figure with big pen
Stick figure pushing

Stick figure pushing
Hiker stick figure

Hiker stick figure
Pedestrian silhouette

Pedestrian silhouette
Walking the dogs vector image

Walking the dogs vector image
Your experience on this site will be improved by allowing cookies.