Lady with magic balls
Home/balls/Lady with magic balls

Lady with magic balls

Vector drawing of a woman holding magic ball in left and right hand.

0.09 MB size 163 downloads 14/12/2015 by j4p4n
↓ Download SVG Large PNG 2400px Small PNG 300px

Public Domain (CC0) · free for commercial use, no attribution required.

Related Tags

ballscreepyfacefemalehandsladywoman Fantasy Elements

Specs

SVG ID
36389
Format
SVG, PNG
License
Public Domain

Related SVG images

See more →
Vintage Lady Riding a Bicycle

Vintage Lady Riding a Bicycle
Vector illustration of quiet lady's face

Vector illustration of quiet lady's face
Lady with hat

Lady with hat
Woman Portrait Polyprismatic Pattern

Woman Portrait Polyprismatic Pattern
Smiling lady portrait

Smiling lady portrait
Vector portrait of middle-aged woman

Vector portrait of middle-aged woman
Korean lady face vector image

Korean lady face vector image
Handkerchief lady

Handkerchief lady
Bored Lady

Bored Lady
Cartoon woman head

Cartoon woman head
Lady portrait

Lady portrait
Face of a lady vector

Face of a lady vector
Your experience on this site will be improved by allowing cookies.